James Rolin

#Father #Husband #Veteran of the #Army and #USCG. #PublicSpeaker . #COO and #cofounder @cowboycrickets

[James Rolin @jamesrolin2]

With the @Boomtown demo day tomorrow, we need all the support that you have to get this thing funded!

[cowboy Cricket Farms @CowboyCrickets]

It’s live! Check out the #Kickstarter for 3 new flavors of whole #crickets ! Our Jumpers are a high #protein and #sustainable #snack of the #future and now you can get the best deal ever… https://t.co/zpfb6KDQOq

[cowboy Cricket Farms @CowboyCrickets]

So thankful and excited about this piece on https://t.co/UdyAY3dX3n by @seanmclainbrown and big shout out to @patriotbootcamp and @TheBunkerLabs for their continued #veteran #support!
#seanmclainbrown #militarydotcom

https://t.co/tfgryAfRyM

[James Rolin @jamesrolin2]

@NickSherman That’s extremely clever!

[Transitions From War @wartransitions]

Happy to be featured on the Headspace and Timing Show!
.
Posted withrepost • @ThCounselingVet Episode 102 of the Head Space And Timing #Podcast is a conversation with Mike Ergo, combat… https://t.co/5Dd1p67ygq

[James Rolin @jamesrolin2]

Wow! So I wasn’t able to contact @United on the phone or online, but I have to commend the staff from flight 2076. They made it happen! On the last flight home!!! I can’t wait to see Kathy and the kids after so long!

[James Rolin @jamesrolin2]

Thanks @united. Just told to turn off my phone... almost 35 minutes on hold and not a peep. No one at your organization cares.

[James Rolin @jamesrolin2]

@TempleLaunchPad I’ll accomplish not getting #home after being gone with the #Army for weeks thanks to @united

[James Rolin @jamesrolin2]

.@united ... please please please delay the flight from Denver to Bozeman tonight... or at least pick up the freaking phone!!!

[James Rolin @jamesrolin2]

@MediaBlackbeard Thanks!

[James Rolin @jamesrolin2]

Incase you’ve wondered why I’ve been a bit quite lately... was busy at OCS. #army #NationalGuard #officer #alabama

[James Rolin @jamesrolin2]

@NabilShah1 Thanks dude! We still need to get you out to visit Montana.

[James Rolin @jamesrolin2]

Something that I need to work on for sure.

[Transitions From War @wartransitions]

I had a great talk with my nutrition coach fireteamwhiskeymilitaryfitness about doing less and spending time with what matters most: family. Sometimes I get so into talking about health… https://t.co/tLCh3iJB3w

[Quality Talk Podcast @Quality_Talk]

Chowing down on crickets. Yes: crickets. @CowboyCrickets @rolin_rolin @jamesrolin2 @AllisonSchwent
https://t.co/DDUHwLii8C

[James Rolin @jamesrolin2]

#cork is the largest dairy area soon, #montana is the largest edible insect producer, what’s next for greater @BlackstoneEI @LaunchPad_MSU ?

[LaunchPad UCC @LaunchPadUCC]

"Cork is set to be the fastest growing dairy area in the world over the next 10 years" according to Prof. Paul Ross at Launch of @UCCFoodInstitut @UCC @SEFSUCC @CorkChamber @Bordbia @Entirl @teagasc @ornua @DairygoldCo_Op @EnterInnov @osheaucc @johbees @Ukilkelly #FoodChain

[James Rolin @jamesrolin2]

@zxq9_notits @muzzm23 @CellPressNews Chirp chirp*

[cowboy Cricket Farms @CowboyCrickets]

At the one of our partner farmers’ thecricketranch inspecting their operation. Little #volcanoes of #eggs ! #montana #cricketsarefood #poweredbycrickets #farm #insect #bug @ Four Corners,… https://t.co/UHyxnj4bUo

[Launchpad at Montana State @LaunchPad_MSU]

Hey innovators, it's time to start thinking about where you want to be by the end of next year in your entrepreneurial journey and start planning the steps it takes to get there. You got this and we are here to help!

[James Rolin @jamesrolin2]

@CLMacLean1 @0SleeptilDawn @SarahloveNature @doktordemirhan Right? That’s exactly what I was thinking.

[cowboy Cricket Farms @CowboyCrickets]

What an amazing night with amazing people! @PhillyVeterans and @TheUnionLeague put on a very well run event. Thank you all! #veteran #veteranowned #TuesdayThoughts #cricketsarefood @NationalGuard @uscg @GrownInMT @Boomtown

[cowboy Cricket Farms @CowboyCrickets]

The kickstarter campaign just hit 200 backers! It’s almost at the $10,000 stretch goal too. Please share and help this campaign be even more… https://t.co/al5Dpowgcc

[James Rolin @jamesrolin2]

@KSmithSpeaking @JeffFlake @SenFeinstein @KamalaHarris @NancyPelosi @CoryBooker @DeptVetAffairs @Rep_Hunter Err! We need to fix this shit! They need to support our vets through actions not words.